The nFOLD3 Server Help Page

Input sequence

Enter the amino acid sequence of your target protein here in single letter format e.g.

	STSCVAEEPIKKIAIFGGTHGNELTGVFLVTHWLKNGAEVHRAGLEVKPFITNPRAVEKC
	TRYIDCDLNRVFDLENLSKEMSEDLPYEVRRAQEINHLFGPKNSDDAYDVVFDLHNTTSN
	MGCTLILEDSRNDFLIQMFHYIKTCMAPLPCSVYLIEHPSLKYATTRSIAKYPVGIEVGP
	QPHGVLRADILDQMRRMLKHALDFIQRFNEGKEFPPCAIDVYKIMEKVDYPRNESGDVAA
	VIHPNLQDQDWKPLHPGDPVFVSLDGKVIPLGGDCTVYPVFVNEAAYYEKKEAFAKTTKL
	TLNAKSIRSTLH
	

If your sequence is longer than about 1000 residues, try breaking it into likely domains before submitting it. The DomFOLD server can help you in doing this.

Email address

Enter your e-mail address here. Results will be returned as soon as they are available.

Short name for sequence

Use this field to assign a short memorable name to your prediction job. This is useful so that you can identify particular jobs in your mailbox. This is particularly important because nFOLD3 will not necessarily return your results in the order you submitted them. The name you specify will be included in the subject line of the e-mail messages sent to you from the server.

Results

The actual format of the email is compatible with the CASP TS format.

The results email contains the top 5 models predicted for your protein. The results are in PDB (Protein Data Bank) format and show the Cartesian coordinates (x,y,z) of the main chain atoms in each model. If you wish to view the models separately you can copy and paste the coordinates of each model into separate files and view them using a molecular viewer such as RasMol.