The DomFOLD Server Help Page

Input sequence

Enter the amino acid sequence of your target protein here in single letter format e.g.

	STSCVAEEPIKKIAIFGGTHGNELTGVFLVTHWLKNGAEVHRAGLEVKPFITNPRAVEKC
	TRYIDCDLNRVFDLENLSKEMSEDLPYEVRRAQEINHLFGPKNSDDAYDVVFDLHNTTSN
	MGCTLILEDSRNDFLIQMFHYIKTCMAPLPCSVYLIEHPSLKYATTRSIAKYPVGIEVGP
	QPHGVLRADILDQMRRMLKHALDFIQRFNEGKEFPPCAIDVYKIMEKVDYPRNESGDVAA
	VIHPNLQDQDWKPLHPGDPVFVSLDGKVIPLGGDCTVYPVFVNEAAYYEKKEAFAKTTKL
	TLNAKSIRSTLH
	

N.B. Sequences less than 100 residues are very likely to be single domain proteins.

Select program

You have a choice of two methods: DomFOLD or DomFOLDpdp. The DomFOLD method is likely to work better for proteins with novel folds. The DomFOLDpdp method is the default and should be used if a fold template can be found for your protein.

Email address

Enter your email address here. Results will be returned as soon as they are available.

Short name for sequence

Use this field to assign a short memorable name to your prediction job. This is useful so that you can identify particular jobs in your mailbox. This is particularly important because DomFOLD will not necessarily return your results in the order you submitted them. The name you specify will be included in the subject line of the e-mail messages sent to you from the server.

Results

The results are formatted in the CASP DP format.