Links to interactive graphical output:

Download model with B-factors
View local errors in Jmol
View coverage and model-template superposition/s in Jmol

RasMol generated image of per-residue accuracy for the model nFOLD4_multi_HHsearch_TS1.bfact.pdb

Click here to download a PDB file of this model with residue accuracy predictions (Angstroms) in the B-factor column.
[RasMol colouring uses the reverse rainbow scheme from blue (high accuracy)
through green, yellow and orange to red (low accuracy).]

Jmol view of the per-residue accuracy for the model nFOLD4_multi_HHsearch_TS1.bfact.pdb

[Jmol colouring uses a gradient from blue (high accuracy)
through white to red (low accuracy).]

Jmol view of the structural alignment of the model (blue) with the template 3mn1A (red) using TM-align

Download the superposition file (RasMol script).

Coverage of target: 0.95811516 (Target length: 191, Aligned residues: 183)
RMSD: 0.58
TM-score: 0.9509
The alignment (template-model) is shown below:

(":" denotes the residue pairs of distance < 5.0 Angstrom)
SLETETM-SQDLMQRGKAIKLAVFDVDGVLTDGRLYFMEDGSEIKTFNTLDGQGIKMLIASGVTTAIISGRKTAIVERRAKSLGIEHLFQGREDKLVVLDKLLAELQLGYEQVAYLGDDLPDLPVIRRVGLGMAVANAASFVREHAHGITRAQGGEGAAREFCELILSAQGNLEAAHSVYLEGH-------
.:::::: ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::       
MSLNTEIEMNELLEKAKKIKCLICDVDGVLSDGLLHIDNHGNELKSFHVQDGMGLKLLMAAGIQVAIITTAQNAVVDHRMEQLGITHYYKGQVDKRSAYQHLKKTLGLNDDEFAYIGDDLPDLPLIQQVGLGVAVSNAVPQVLEFADWRTERTGGRGAVRELCDLILNAQNKAELAITGYLKQEGHHHHHH

Jmol view of the structural alignment of the model (blue) with the template 3mmzA (red) using TM-align

Download the superposition file (RasMol script).

Coverage of target: 0.84816754 (Target length: 191, Aligned residues: 162)
RMSD: 1.84
TM-score: 0.78722
The alignment (template-model) is shown below:

(":" denotes the residue pairs of distance < 5.0 Angstrom)
-------SLGALPT-AEDIDAVVLDFDGTQTDDRVLIDSDGREFVSVHRGDGLGIAALRKSGLT-LILSTEQNPVVAARARKLKI-PVLHGIDRKDLALKQWCEEQGIAPERVLYVGNDVNDLPCFALVGWPVAVASAHDVVRGAARAVTTVPGGDGAIREIASWILG----PSLD---------------
       ...:::. .:::::::::::::::::::::::::::::::::::::::::::::::: :::::::::::::::::::: ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::    .:.:               
MSLNTEIEMNELLEKAKKIKCLICDVDGVLSDGLLHIDNHGNELKSFHVQDGMGLKLLMAAGIQVAIITTAQNAVVDHRMEQLGITHYYKGQVDKRSAYQHLKKTLGLNDDEFAYIGDDLPDLPLIQQVGLGVAVSNAVPQVLEFADWRTERTGGRGAVRELCDLILNAQNKAELAITGYLKQEGHHHHHH