Links to interactive graphical output:

Download model with B-factors
View local errors in Jmol
View coverage and model-template superposition/s in Jmol

RasMol generated image of per-residue accuracy for the model nFOLD4_3e8mA_COMA_TS7.bfact.pdb

Click here to download a PDB file of this model with residue accuracy predictions (Angstroms) in the B-factor column.
[RasMol colouring uses the reverse rainbow scheme from blue (high accuracy)
through green, yellow and orange to red (low accuracy).]

Jmol view of the per-residue accuracy for the model nFOLD4_3e8mA_COMA_TS7.bfact.pdb

[Jmol colouring uses a gradient from blue (high accuracy)
through white to red (low accuracy).]

Jmol view of the structural alignment of the model (blue) with the template 3e8mA (red) using TM-align

Download the superposition file (RasMol script).

Coverage of target: 0.8429319 (Target length: 191, Aligned residues: 161)
RMSD: 0.98
TM-score: 0.82866
The alignment (template-model) is shown below:

(":" denotes the residue pairs of distance < 5.0 Angstrom)
---------------MKEIKLILTDIDGVWTDGGMFYDQTGNEWKKFNTSDSAGIFWAHNKGIPVGILTGEKTEIVRRRAEKLKVDYLFQGVVDKLSAAEELCNELGINLEQVAYIGDDLNDAKLLKRVGIAGVPASAPFYIRRLSTIFLEKRGGEGVFREFVEKVLGINLEDFIAVIQ---------------
               :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: .:.                 
MSLNTEIEMNELLEKAKKIKCLICDVDGVLSDGLLHIDNHGNELKSFHVQDGMGLKLLMAAGIQVAIITTAQNAVVDHRMEQLGITHYYKGQVDKRSAYQHLKKTLGLNDDEFAYIGDDLPDLPLIQQVGLGVAVSNAVPQVLEFADWRTERTGGRGAVRELCDLILNAQNKA-ELA--ITGYLKQEGHHHHHH