Links to interactive graphical output:

Download model with B-factors
View local errors in Jmol
View coverage and model-template superposition/s in Jmol

RasMol generated image of per-residue accuracy for the model nFOLD4_2p9jA_HHsearch_TS7.bfact.pdb

Click here to download a PDB file of this model with residue accuracy predictions (Angstroms) in the B-factor column.
[RasMol colouring uses the reverse rainbow scheme from blue (high accuracy)
through green, yellow and orange to red (low accuracy).]

Jmol view of the per-residue accuracy for the model nFOLD4_2p9jA_HHsearch_TS7.bfact.pdb

[Jmol colouring uses a gradient from blue (high accuracy)
through white to red (low accuracy).]

Jmol view of the structural alignment of the model (blue) with the template 2p9jA (red) using TM-align

Download the superposition file (RasMol script).

Coverage of target: 0.8115183 (Target length: 191, Aligned residues: 155)
RMSD: 0.23
TM-score: 0.80995
The alignment (template-model) is shown below:

(":" denotes the residue pairs of distance < 5.0 Angstrom)
----------ALRDRVKKLKLLI-DIDGVLTDGKLYYTEHGETIKVFNVLDGIGIKLLQK-GITLAVISGRDSAPLITRLKELGVEEIYTGS--KLEIYEKIKEKYSLKDEEIGFIGDDVVDIEV-KKVGFPVAVRNAVEEVRKVAVYITQRNGGEGALREVAELIHFLK---------------------
          ::::::::::::: :::::::::::::::::::::::::::::::::::: :::::::::::::::::::::::::::::::  ::::::::::::::::::::::::::::::: ::::::::::::::::::::::::::::::::::::::::::::                     
MSLNTEIEMNELLEKAKKIKCLICDVDGVLSDGLLHIDNHGNELKSFHVQDGMGLKLLMAAGIQVAIITTAQNAVVDHRMEQLGITHYYKGQVDKRSAYQHLKKTLGLNDDEFAYIGDDLPDLPLIQQVGLGVAVSNAVPQVLEFADWRTERTGGRGAVRELCDLILNAQNKAELAITGYLKQEGHHHHHH