Links to interactive graphical output:
RasMol generated image of per-residue accuracy for the model nFOLD4_1k1eA_COMA_TS5.bfact.pdb
Click here to download a PDB file of this model with residue accuracy predictions (Angstroms) in the B-factor column.
[RasMol colouring uses the reverse rainbow scheme from blue (high accuracy)
through green, yellow and orange to red (low accuracy).]
Jmol view of the per-residue accuracy for the model nFOLD4_1k1eA_COMA_TS5.bfact.pdb
[Jmol colouring uses a gradient from blue (high accuracy)
through white to red (low accuracy).]
Jmol view of the structural alignment of the model (blue) with the template 1k1eA (red) using TM-align
Download the superposition file (RasMol script).
Coverage of target: 0.88481677 (Target length: 191, Aligned residues: 169)
RMSD: 1.05
TM-score: 0.87306
The alignment (template-model) is shown below:
(":" denotes the residue pairs of distance < 5.0 Angstrom)
--------------KLENIKFVITDVDGVLTDGQLHYDANGEAIKSFHVRDGLGIKMLMDADIQVAVLSGRDSPILRRRIADLGIKLFFLGKLEKETACFDLMKQAGVTAEQTAYIGDDSVDLPAFAACGTSFAVADAPIYVKNAVDHVLSTHGGKGAFREMSDMILQAQGK-SSV---FDTAQGFL-KSVKSMGQ---
:::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: ::: ::::::. .
MSLNTEIEMNELLEKAKKIKCLICDVDGVLSDGLLHIDNHGNELKSFHVQDGMGLKLLMAAGIQVAIITTAQNAVVDHRMEQLGITHYYKGQVDKRSAYQHLKKTLGLNDDEFAYIGDDLPDLPLIQQVGLGVAVSNAVPQVLEFADWRTERTGGRGAVRELCDLILNAQNKAELAITGYLKQEGH-HH-------HHH