Links to interactive graphical output:
RasMol generated image of per-residue accuracy for the model nFOLD4_1lc0a1_spk2_TS7.bfact.pdb
Click here to download a PDB file of this model with residue accuracy predictions (Angstroms) in the B-factor column.
[RasMol colouring uses the reverse rainbow scheme from blue (high accuracy)
through green, yellow and orange to red (low accuracy).]
Jmol view of the per-residue accuracy for the model nFOLD4_1lc0a1_spk2_TS7.bfact.pdb
[Jmol colouring uses a gradient from blue (high accuracy)
through white to red (low accuracy).]
Jmol view of the structural alignment of the model (blue) with the template 1lc0A (red) using TM-align
Download the superposition file (RasMol script).
Coverage of target: 0.95862067 (Target length: 145, Aligned residues: 139)
RMSD: 1.71
TM-score: 0.86362
The alignment (template-model) is shown below:
(":" denotes the residue pairs of distance < 5.0 Angstrom)
MITNSGKFGVVVVGVGRAGSVRLRDLKDPRSAAFLNLIGFVSRRELGSLDEVRQISLEDALRSQEIDVAYI-CSESS-SHEDYIRQFLQAGKHVLVEYPMTLSFAAAQELWELAAQKGRVLHEEHVELLMEEFEFLRREVLGKELLKGSLRFTASPLEEERFGFPAFSGISRLTWLVSLFGELSLISATLEERKEDQYMKMTVQLETQNKGLLSWIEEKGPGLKRNRYVNFQFTSGSLEEVPSVGVNKNIFLKDQDIFVQKLLDQVSAEDLAAEKKRIMHCLGLASDIQK-LC---
:::::::::::::::::::::::::.::::::::: : ::: :::: ::::::::::::::: ::::: ::::::::::::::::::: ::::::::::::::::: ::::. .: :: : :::::::::::::::::::::::::::: ::
---------VELIGRSEWINQYRRRLQQLSETDIAVWLYGAPGT-G-RMT-GARY-LHQFGRNAQGEFVYRELTPDNAPQLNDFIALAQGGTLVLSH-PEHLTREQQYHLVQLQS--QEHRP-----------------------------------------------------------------------------------------------------------------------------------FR-LI--G-IGDTSLVELAASNHIIAELYYCFAMTQIACLPLT