Links to interactive graphical output:
RasMol generated image of per-residue accuracy for the model nFOLD4_2j66a_spk2_TS6.bfact.pdb
Click here to download a PDB file of this model with residue accuracy predictions (Angstroms) in the B-factor column.
[RasMol colouring uses the reverse rainbow scheme from blue (high accuracy)
through green, yellow and orange to red (low accuracy).]
Jmol view of the per-residue accuracy for the model nFOLD4_2j66a_spk2_TS6.bfact.pdb
[Jmol colouring uses a gradient from blue (high accuracy)
through white to red (low accuracy).]
Jmol view of the structural alignment of the model (blue) with the template 2j66A (red) using TM-align
Download the superposition file (RasMol script).
Coverage of target: 0.9589041 (Target length: 365, Aligned residues: 350)
RMSD: 1.96
TM-score: 0.90695
The alignment (template-model) is shown below:
(":" denotes the residue pairs of distance < 5.0 Angstrom)
DQAEITALTKRFETPFYLYDGDFIEAHYRQLRSRT-NPAIQFYLSLKANNNIHLAKLFRQWGLGVEVASAGELALARHAGFSAENIIFSGPGKKRSELEIAVQSGIYCIIAESVEELFYIEELAEKENKTARVAIRINPDKSFTAIKMGGVPRQF--GMDESMLDAVMDAVRSLQFTKFIGIHVYTGTQNLNTDSIIESMKYTVDLGRNIYERYGIVCECINLGGGFGVPYFEKALDIGKITRTVSDYVQEARDTRFPQTTFIIESGRYLLAQAAVYVTEVLYRKASKGEVFVIVD----GGMHHHAA--S-PMEYIP-LEK-VTIAGPLCTPEDCLGKDVHVPALYPGDLVCVLNSGAYGLSFSPVH-FLGHPTPIEILKRN-GSYELIRRKGTADDIVATQ-L
:: ::::::::::::::::::::::: :::::::::::::::::::::::::::::::::::::::::: ::::::::::: ::::::::::::: :::::::::::::::::::: :::::::::::::::::::::::::: :::: :::::::::: :::::::: :: ::::: ::::::::::::::::::::::::::::: ::::: :::::::::::::::::::: : ::::::::::::::::::::::::::::: ::::::: :::::::: : ::::.. ::: :::::::::::::::::::::::::::::::::: : :::::::: :::::::::::::: :::::::::::::.... .
-------MI---ETPYYLIDKAKLTRNMERIAHVREKSGAKALLALKCFATWSVFDLMRDYMDGTTSSSLFEVRLGRE-RFGKETHAYSV-AYGDNEIDEVVSH-ADKIIFNSISQLERFADKAA----GIARGLRLNPQVSSSSFDLADPARPFSRLGEW-DVPKVERVMD-----RINGFMIH-NN-CENKD--FGLFDRMLGEIEERFGALIARVDWVSLGG-GIHFT-GDDYPVDAFSARLRAFSDRY----G--VQIYLEPGEASITKSTTLEVTVLDTLYNG-KNLAIVDSSIEAHMLDLLIYRETAKVLPNEGSHSYMICGKSCLAGDVFGEFRFAEELKVGDRISFQDA-A-GYTMVKKNWFNGVKMPAIAIRELDGSVRTVREFTYADYEQS--LS