Links to interactive graphical output:

Download model with B-factors
View local errors in Jmol
View coverage and model-template superposition/s in Jmol

RasMol generated image of per-residue accuracy for the model nFOLD4_1knwA_HHsearch_TS6.bfact.pdb

Click here to download a PDB file of this model with residue accuracy predictions (Angstroms) in the B-factor column.
[RasMol colouring uses the reverse rainbow scheme from blue (high accuracy)
through green, yellow and orange to red (low accuracy).]

Jmol view of the per-residue accuracy for the model nFOLD4_1knwA_HHsearch_TS6.bfact.pdb

[Jmol colouring uses a gradient from blue (high accuracy)
through white to red (low accuracy).]

Jmol view of the structural alignment of the model (blue) with the template 1knwA (red) using TM-align

Download the superposition file (RasMol script).

Coverage of target: 0.98356164 (Target length: 365, Aligned residues: 359)
RMSD: 1.21
TM-score: 0.95796
The alignment (template-model) is shown below:

(":" denotes the residue pairs of distance < 5.0 Angstrom)
PHSLFSTDTDLTAENLLRLPAEFGCPVWVYDAQIIRRQIAALKQF-----DVVRFAQKACSNIHILRLMREQGVKVDSVSLGEIERALAAGYNPQTHPDDIVFTADVIDQATLERVSELQIPVNAGSVDMLDQLGQVSPGHRVWLRVNPGFGHGHSQKTNTGGENSKHGIWYTDLPAALDVIQRHHLQLVGIHMHIGSGVDY-AHLEQVCGAMVRQVIEFGQDLQAISAGGGLSVPYQQGEEAVDTEHYYGLWNAAREQIARHLGHPVKLEIEPGRFLVAQSGVLITQVRSVKQMGSRHFVLVDAGFNDLMRPAMYGSYHHISALAADGRSLEHAPTVETVVAGPLCESGDVFTQQEGGNVETRALPEVKAGDYLVLHDTGAYGASMSSNYNSRPLLPEVLFDNGQARLIRRRQTIEELLALELLHH
                     ::::::::::::::::::::::::     :::::::::::::::::::::::::::::::::::::::: :::    ::::::: :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::  :   :::: :::::::::::: :::::::::::::::::::::::::::::::::: :  .: :::::::::::::: ::     :::::::::::::::::::::::::::::: :::::::::::::::::: ::::::::::     :  ::::::::::::::::::::::      .::: :::::::::::::::::::::::::::::::::::::::::::::::::::::::::   
---------------------MIETPYYLIDKAKLTRNMERIAHVREKSGAKALLALKCFATWSVFDLMRDYMDGTTSSSLFEVRLGRER-FGK----ETHAYSV-AYGDNEIDEVVSHADKIIFNSISQLERFADKAAGIARGLRLNPQVSSSSFDLADPARPFSRLGEWDVPKVERV--M---DRIN-GFMIHNNCENKDFGLFDRMLGEIEERFGALIARVDWVSLGGGIHFTG-D--DY-PVDAFSARLRAFSD-RY-----GVQIYLEPGEASITKSTTLEVTVLDTLYNG-KNLAIVDSSIEAHMLDLL-IYRETAKVLP-----N--EGSHSYMICGKSCLAGDVFGEF------RFAE-ELKVGDRISFQDAAGYTMVKKNWFNGVKMPAIAIRELDGSVRTVREFTYADYEQSLS---